Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectstropicalmeadow
Larkspur Flower from Larkspur
Orchids from Orchid
Caterpillar and Buttefly from Caterpillar
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Lavender from Plants ii coloring book
Bee from Cartoon animals coloring book
Swallow Tail Hummingbird from Hummingbirds
Steampunk Bee from Steampunk animals coloring book
Cosmos Scabiosoides from Cosmos
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Apple Blossom Branch from Apple tree
Butterfly from Cartoon animals viii coloring book
Bee from Cartoon animals v coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Daffodil from Daffodil
Bumblebee from Woodland animals
Orchid Lycaste Aromatica from Orchid
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Pollinators of Alaska from Nps
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Chrysanthemum 1 from Perennial
Black Elderberry from Elderberry
Disa Kewensis Orchid from Orchid
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Bee from Cartoon animals viii coloring book
Common Fruit Bats from Realistic animals coloring book
Black Raspberry from Celebrating wildflowers coloring book
Heliconia Indica from Heliconia
Chinese Peony from Flowers
Hibiscus Flower from Hawaii flower
Spring Crocus from Crocus
Cherokee Rose from Roses
Bug from Animals
Hibiscus from Realistic flowers
Butterfly from Cartoon animals vii coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals viii coloring book
Realistic Sunflowers from Sunflower
Masdevallia Coccinea Orchid from Orchid
Renanthera Imschootiana Orchid from Orchid
Saskatoon from Serviceberry
Grasshopper on the Flower from Grasshoppers
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Hummingbird from Cartoon animals ii coloring book
Schlumbergera Bloom from Cactus
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Aquilegia Truncata Red Columbine from Columbine
Clarkia Amoena Farewell to Spring from Godetia
Cirsium Vulgare or Bull Thistle from Thistle
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Oriental poppy from Perennial
Viola Adunca or Pale Mountain Violet from Violet
Daffodil Flowers from Daffodil
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Cornflower, Blue Bottle from Cornflowers
Ranunculus Acris from Buttercup
Burke's Larkspur from Celebrating wildflowers coloring book
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Butterfly Flies On A Flower from Flowers
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Chrysanthemum Morifolium from Flower garden
Pink Hibiscus from Realistic flowers
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Anemone Coronaria from Anemone
Life Cycle of Monarch Butterfly from Biology
Blooming Sunflower from Sunflower
Daffodil from Daffodil
Chrysanthemum Carinatum from Realistic flowers
Grasshopper on Flower from Grasshoppers
Common Evening Primrose or Evening Star from Primrose
Aster 1 from Asters
Tropical Vanda Tricolor Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Sophronitis Cernua Orchid from Orchid
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
201 - 300 of 1,830 Next page
/ 19